PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009787892.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family bZIP
Protein Properties Length: 304aa    MW: 32928.8 Da    PI: 5.9882
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009787892.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1301.2e-09214262553
                     CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelk 53 
                     kr++r   NR +A rs +RK  +i+eLe++v++L++e ++L  +l  l+
  XP_009787892.1 214 KRAKRIWANRQSAARSKERKMRYIAELERRVQALQTEATSLSAQLTLLQ 262
                     9*****************************************9998775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.9E-14210274IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.898212275IPR004827Basic-leucine zipper domain
PfamPF001708.8E-9214262IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.9E-8214262No hitNo description
SuperFamilySSF579591.62E-10214265No hitNo description
CDDcd147039.06E-24215264No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MDKEKCVGGL LPPSGNYSLF LPSGSSYSVK SEPSGSSNLP PLGPVPASEL KANQFSHDIS  60
RMPDNPPKNL GHRRAHSEIL TLPDDISFDS DLGVVGGLDG PSLSDETEED FLSMYLDMDK  120
FNSSSATSSF QVGESSSGSL QAPAMGFTAS RTDNVSAAVS EKPRVRHQHS QSMDGSTIIK  180
PEMLMSGGED PSSAETKKAM SAAKLAELAL IDPKRAKRIW ANRQSAARSK ERKMRYIAEL  240
ERRVQALQTE ATSLSAQLTL LQRDTNGLSA ENNELKLRLQ TMEQQVHLQD GKKLNMTSSS  300
LSEN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009787892.10.0PREDICTED: probable transcription factor PosF21 isoform X1
SwissprotQ040881e-123POF21_ARATH; Probable transcription factor PosF21
TrEMBLA0A068VB621e-156A0A068VB62_COFCA; Uncharacterized protein
STRINGSolyc06g053350.2.11e-145(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA39652137
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06070.11e-116bZIP family protein